PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G128900.1.p
Common NameSb03g010960, SORBIDRAFT_03g010960
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 304aa    MW: 32773.3 Da    PI: 7.5433
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G128900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.6e-1757102147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           rg W + Ed +l+++v+q+G+ +W++Ia+++  gR++k+c++rw++ 
  Sobic.003G128900.1.p  57 RGHWRPAEDAKLKELVAQYGPQNWNLIAERLD-GRSGKSCRLRWFNQ 102
                           899*****************************.***********996 PP

2Myb_DNA-binding57.53.2e-18109153147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           r ++++eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ +
  Sobic.003G128900.1.p 109 RRAFSEEEEERLLAAHRAYGNK-WALIARLFP-GRTDNAVKNHWHVL 153
                           678*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.51252103IPR017930Myb domain
SMARTSM007172.0E-1456105IPR001005SANT/Myb domain
SuperFamilySSF466894.87E-2857150IPR009057Homeodomain-like
PfamPF002492.4E-1657102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2658110IPR009057Homeodomain-like
CDDcd001676.07E-1460101No hitNo description
PROSITE profilePS5129427.733104158IPR017930Myb domain
SMARTSM007178.8E-16108156IPR001005SANT/Myb domain
PfamPF002493.4E-15109153IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-21111157IPR009057Homeodomain-like
CDDcd001676.16E-8120154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MAAFFGAAPP PPPPPGLASF HHHEEEEQQH HKDAAEEVYH VDDVDEGGAG QGKLCARGHW  60
RPAEDAKLKE LVAQYGPQNW NLIAERLDGR SGKSCRLRWF NQLDPRINRR AFSEEEEERL  120
LAAHRAYGNK WALIARLFPG RTDNAVKNHW HVLMARKQRE QTGALRRRKP SSSSSSSPGP  180
APTPHFAPVV VLHHHHYAGS PPMPLHATAG AYTTAAAAAD TRAHSGGESD ETASTCTTDL  240
SLGSAAAPCF YQSGYDVVPR AAAFAPSARS AFSAPSATAR HGEARSDDKV SLPFFDFLGV  300
GAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-33551575107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9648550.0EU964855.1 Zea mays clone 282116 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457638.10.0hypothetical protein SORBIDRAFT_03g010960
TrEMBLC5XH760.0C5XH76_SORBI; Putative uncharacterized protein Sb03g010960
STRINGSb03g010960.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.13e-57myb domain protein 105